PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID IGS.gm_5_00099
Common NameCHLNCDRAFT_142770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family G2-like
Protein Properties Length: 525aa    MW: 49756.1 Da    PI: 7.6005
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
IGS.gm_5_00099genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like871.8e-27204257155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rl+Wt+eLH+rF++a+++L G ++A+Pk+il +m+v+g+t+e+v+SHLQkYRl
  IGS.gm_5_00099 204 KARLVWTQELHNRFINALSHL-GLKNAVPKSILAMMNVDGMTRENVASHLQKYRL 257
                     68*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.286201260IPR017930Myb domain
SuperFamilySSF466892.33E-18202261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27202262IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24204257IPR006447Myb domain, plants
PfamPF002497.7E-7207256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MGPAALSGAA APASAVPALR PVSRPAGGGP QVPQQGMAAG PATQSPSPLL APTRPQPLVP  60
AMPAAGAAAA VPPPAGSAAV PGAVLGMKRK ADAVQQGQPA RILPVPGMPA VGVPMLPHPA  120
AAATAVVGQP IETVAGAGLL PPPPHPSPGH GGSAQTDGGS SDDDEAPGAG AGGEAQASEA  180
ASAAAAAAAS AAAGGEVHGG HNRKARLVWT QELHNRFINA LSHLGLKNAV PKSILAMMNV  240
DGMTRENVAS HLQKYRLYLR RLGGLSDKDR ADADALQRLH EQNVQAMAAQ QMLQHSLAAM  300
QGPPAGVLAA MGIGGYAYEH QAGQVQGQPA AAAGGGAAAP MGPQQAGALA APLPLKVGEV  360
GGGAAAPPSS GLASLANLAA AGLADLAAAA AGSGAAGTGG SSSSSPPLPA AGAGAVAGPG  420
PRPVPGIQGV PLAASLDLAA PPVQPTWAGE HANGSRAVAA AAPSLPGPGN TAAPAFGTGA  480
DGDANGTAHS HHLGPRAAAA ADGAAGKPTP AAVIWATAPG TPPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-21203262463ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005849749.10.0hypothetical protein CHLNCDRAFT_142770
TrEMBLE1Z8Q00.0E1Z8Q0_CHLVA; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.11e-19G2-like family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]